PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G1565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 285aa    MW: 34249.3 Da    PI: 7.665
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G1565genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.32.4e-2439121186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k lWe +s +mre+gf+rs +qCk+kw+nl +ryk ++++e++     ++++p++++l+
  Gh_D09G1565  39 QWSIQETKEFLMIRAELDRSFMETKRNKLLWEVISTRMREKGFNRSTEQCKCKWKNLVTRYKGCETMEEEA---MRQQFPFYNELQ 121
                  7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.36E-2138103No hitNo description
PfamPF138377.0E-2039123No hitNo description
PROSITE profilePS500907.3174096IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEGHQHHHHQ YQQQQYQYHQ QQQQPPTSSV NVDADRFPQW SIQETKEFLM IRAELDRSFM  60
ETKRNKLLWE VISTRMREKG FNRSTEQCKC KWKNLVTRYK GCETMEEEAM RQQFPFYNEL  120
QAIFSARMQS ILWSESEGGA TGSKRKAVQL SSDEEEDTEE KELEKSSVRK KKQGKTSGGA  180
GIGGSTSGNG NNSNNIKEIL EDFMRQQMQM EMQWREAFEA REHERRLKEM EWRQKMEALE  240
NERILMDRRW YEREEQRRIR EEARAEKRDA LITALLNKLR RDDHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1236119386DNA binding protein GT-1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1277682e-77JN127768.1 Theobroma cacao clone TCC_BC011L18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486231.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotO804502e-75TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0D2QCA70.0A0A0D2QCA7_G
STRINGPOPTR_0006s10240.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.16e-54Trihelix family protein